PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P19900_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family NAC
Protein Properties Length: 328aa    MW: 36102.6 Da    PI: 6.2915
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P19900_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.87.2e-5651301128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeel+++yL++kv++ ++ + ++i++vdi+k+ePwdLp k++ +ekewyfFs +d+ky+tg r+nrat++gyWk+tg
  GSMUA_Achr10P19900_001   5 LPPGFRFHPTDEELITYYLTRKVTEFSFAT-RAIADVDINKCEPWDLPGKASMGEKEWYFFSMKDRKYPTGLRTNRATDAGYWKTTG 90 
                             79*************************999.88***************988999********************************* PP

                     NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             kdke+++  g +vg+kktLvfykgrap+gekt+Wvmheyrl
  GSMUA_Achr10P19900_001  91 KDKEIFH-CGVVVGMKKTLVFYKGRAPRGEKTSWVMHEYRL 130
                             *******.9******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-643159IPR003441NAC domain
PROSITE profilePS5100559.6035159IPR003441NAC domain
PfamPF023657.5E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MEETLPPGFR FHPTDEELIT YYLTRKVTEF SFATRAIADV DINKCEPWDL PGKASMGEKE  60
WYFFSMKDRK YPTGLRTNRA TDAGYWKTTG KDKEIFHCGV VVGMKKTLVF YKGRAPRGEK  120
TSWVMHEYRL QTSCTAEGGV GSLSFFLQEE WVVCRVFRKS PTGKKPQPDS PAMPASLESQ  180
GELDVSVLNK LVGSSGFDRL QTDYSLCNSN SSGRLDMNWF LARAAAAGQA SLPWASGLLA  240
SGLAPSPAIP KGLSFNGQQQ PEGVVDVAGL TSFVAQGDAL FGNDLKSSFP TASSSIGVEC  300
AQQQQEPPPP PQQQQTQSFN QESIWSSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-55416516171NO APICAL MERISTEM PROTEIN
1ut4_B2e-55416516171NO APICAL MERISTEM PROTEIN
1ut7_A2e-55416516171NO APICAL MERISTEM PROTEIN
1ut7_B2e-55416516171NO APICAL MERISTEM PROTEIN
3swm_A2e-55416519174NAC domain-containing protein 19
3swm_B2e-55416519174NAC domain-containing protein 19
3swm_C2e-55416519174NAC domain-containing protein 19
3swm_D2e-55416519174NAC domain-containing protein 19
3swp_A2e-55416519174NAC domain-containing protein 19
3swp_B2e-55416519174NAC domain-containing protein 19
3swp_C2e-55416519174NAC domain-containing protein 19
3swp_D2e-55416519174NAC domain-containing protein 19
4dul_A2e-55416516171NAC domain-containing protein 19
4dul_B2e-55416516171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009380301.10.0PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ25e-77NC100_ARATH; NAC domain-containing protein 100
TrEMBLM0RJR50.0M0RJR5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P19900_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-87NAC domain containing protein 58